Lineage for d1fjeb2 (1fje B:92-175)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2558726Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2558887Protein Nucleolin [54952] (2 species)
  7. 2558888Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [54953] (4 PDB entries)
  8. 2558890Domain d1fjeb2: 1fje B:92-175 [39211]
    protein/RNA complex

Details for d1fjeb2

PDB Entry: 1fje (more details)

PDB Description: solution structure of nucleolin rbd12 in complex with snre rna
PDB Compounds: (B:) nucleolin rbd12

SCOPe Domain Sequences for d1fjeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjeb2 d.58.7.1 (B:92-175) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
dskkvraartllaknlsfnitedelkevfedaleirlvsqdgkskgiayiefkseadaek
nleekqgaeidgrsvslyytgekg

SCOPe Domain Coordinates for d1fjeb2:

Click to download the PDB-style file with coordinates for d1fjeb2.
(The format of our PDB-style files is described here.)

Timeline for d1fjeb2:

2558890
d1fjeb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1fjeb1