Lineage for d1fg5n_ (1fg5 N:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1001844Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1001845Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1002128Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
  6. 1002129Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)
  7. 1002130Species Cow (Bos taurus) [TaxId:9913] [64133] (22 PDB entries)
    Uniprot P14769
  8. 1002165Domain d1fg5n_: 1fg5 N: [59816]

Details for d1fg5n_

PDB Entry: 1fg5 (more details), 2.8 Å

PDB Description: crystal structure of bovine alpha-1,3-galactosyltransferase catalytic domain.
PDB Compounds: (N:) n-acetyllactosaminide alpha-1,3-galactosyltransferase

SCOPe Domain Sequences for d1fg5n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fg5n_ c.68.1.9 (N:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
kyfllnkptkilspeycwdyhiglpadiklvkmswqt

SCOPe Domain Coordinates for d1fg5n_:

Click to download the PDB-style file with coordinates for d1fg5n_.
(The format of our PDB-style files is described here.)

Timeline for d1fg5n_: