Lineage for d1fewa_ (1few A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985818Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985970Superfamily a.7.4: Smac/diablo [46984] (1 family) (S)
    automatically mapped to Pfam PF09057
  5. 1985971Family a.7.4.1: Smac/diablo [46985] (2 proteins)
    this is a repeat family; one repeat unit is 1few A: found in domain
  6. 1985972Protein Smac/diablo [46986] (1 species)
  7. 1985973Species Human (Homo sapiens) [TaxId:9606] [46987] (2 PDB entries)
  8. 1985976Domain d1fewa_: 1few A: [16334]

Details for d1fewa_

PDB Entry: 1few (more details), 2.2 Å

PDB Description: crystal structure of smac/diablo
PDB Compounds: (A:) second mitochondria-derived activator of caspases

SCOPe Domain Sequences for d1fewa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fewa_ a.7.4.1 (A:) Smac/diablo {Human (Homo sapiens) [TaxId: 9606]}
slssealmrravslvtdststflsqttyalieaiteytkavytltslyrqytsllgkmns
eeedevwqviigaraemtskhqeylklettwmtavglsemaaeaayqtgadqasitarnh
iqlvklqveevhqlsrkaetklaeaqieelkqktqeegeeraeseqeaylred

SCOPe Domain Coordinates for d1fewa_:

Click to download the PDB-style file with coordinates for d1fewa_.
(The format of our PDB-style files is described here.)

Timeline for d1fewa_: