Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (9 families) |
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
Protein Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) [48462] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48463] (1 PDB entry) |
Domain d1fcha_: 1fch A: [19212] complexed with the pts1 peptide |
PDB Entry: 1fch (more details), 2.2 Å
SCOPe Domain Sequences for d1fcha_:
Sequence, based on SEQRES records: (download)
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} satydkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylg ttqaeneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpay ahlvtpaeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgv lfnlsgeydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyi rsrynlgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgq sdaygaadardlstlltmfglpq
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} satydkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylg ttqaeneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpay ahlvtrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcf taalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlga hreavehflealnmqrksggamseniwstlrlalsmlgqsdaygaadardlstlltmfgl pq
Timeline for d1fcha_: