Lineage for d1f3dj2 (1f3d J:108-213)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) Species Mouse (Mus musculus) [TaxId:10090] [88567] (368 PDB entries)
Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
Domain d1f3dj2: 1f3d J:108-213 [21425]
Other proteins in same PDB: d1f3dh1, d1f3dh2, d1f3dj1, d1f3dk1, d1f3dk2, d1f3dl1
part of catalytic Fab 4B2
complexed with so4, tpm
Details for d1f3dj2
PDB Entry: 1f3d (more details), 1.87 Å
PDB Description: catalytic antibody 4b2 in complex with its amidinium hapten.
PDB Compounds: (J:) catalytic antibody 4b2SCOPe Domain Sequences for d1f3dj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3dj2 b.1.1.2 (J:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrna
SCOPe Domain Coordinates for d1f3dj2:
Click to download the PDB-style file with coordinates for d1f3dj2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f3dj2:
View in 3D
