Lineage for d1exka_ (1exk A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894238Fold g.54: DnaJ/Hsp40 cysteine-rich domain [57937] (1 superfamily)
    metal(zinc)-bound extended beta-hairpin fold
  4. 894239Superfamily g.54.1: DnaJ/Hsp40 cysteine-rich domain [57938] (1 family) (S)
  5. 894240Family g.54.1.1: DnaJ/Hsp40 cysteine-rich domain [57939] (2 proteins)
  6. 894241Protein Cysteine-rich domain of the chaperone protein DnaJ [57940] (1 species)
  7. 894242Species Escherichia coli [TaxId:562] [57941] (1 PDB entry)
  8. 894243Domain d1exka_: 1exk A: [45384]
    complexed with zn

Details for d1exka_

PDB Entry: 1exk (more details)

PDB Description: solution structure of the cysteine-rich domain of the escherichia coli chaperone protein dnaj.
PDB Compounds: (A:) dnaj protein

SCOP Domain Sequences for d1exka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]}
gvtkeiriptleecdvchgsgakpgtqpqtcptchgsgqvqmrqgffavqqtcphcqgrg
tlikdpcnkchghgrvers

SCOP Domain Coordinates for d1exka_:

Click to download the PDB-style file with coordinates for d1exka_.
(The format of our PDB-style files is described here.)

Timeline for d1exka_: