Class g: Small proteins [56992] (54 folds) |
Fold g.54: Cysteine-rich domain of the chaperone protein DnaJ. [57937] (1 superfamily) |
Superfamily g.54.1: Cysteine-rich domain of the chaperone protein DnaJ. [57938] (1 family) |
Family g.54.1.1: Cysteine-rich domain of the chaperone protein DnaJ. [57939] (1 protein) |
Protein Cysteine-rich domain of the chaperone protein DnaJ. [57940] (1 species) |
Species Escherichia coli [TaxId:562] [57941] (1 PDB entry) |
Domain d1exka_: 1exk A: [45384] |
PDB Entry: 1exk (more details)
SCOP Domain Sequences for d1exka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ. {Escherichia coli} gvtkeiriptleecdvchgsgakpgtqpqtcptchgsgqvqmrqgffavqqtcphcqgrg tlikdpcnkchghgrvers
Timeline for d1exka_: