Lineage for d1exka_ (1exk A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41885Fold g.54: Cysteine-rich domain of the chaperone protein DnaJ. [57937] (1 superfamily)
  4. 41886Superfamily g.54.1: Cysteine-rich domain of the chaperone protein DnaJ. [57938] (1 family) (S)
  5. 41887Family g.54.1.1: Cysteine-rich domain of the chaperone protein DnaJ. [57939] (1 protein)
  6. 41888Protein Cysteine-rich domain of the chaperone protein DnaJ. [57940] (1 species)
  7. 41889Species Escherichia coli [TaxId:562] [57941] (1 PDB entry)
  8. 41890Domain d1exka_: 1exk A: [45384]

Details for d1exka_

PDB Entry: 1exk (more details)

PDB Description: solution structure of the cysteine-rich domain of the escherichia coli chaperone protein dnaj.

SCOP Domain Sequences for d1exka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ. {Escherichia coli}
gvtkeiriptleecdvchgsgakpgtqpqtcptchgsgqvqmrqgffavqqtcphcqgrg
tlikdpcnkchghgrvers

SCOP Domain Coordinates for d1exka_:

Click to download the PDB-style file with coordinates for d1exka_.
(The format of our PDB-style files is described here.)

Timeline for d1exka_: