Lineage for d1euqa1 (1euq A:339-547)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672943Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 672944Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) (S)
  5. 672964Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)
  6. 672965Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (1 species)
    duplication, consists of two barrel domains with the swapping of N-terminal strands
  7. 672966Species Escherichia coli [TaxId:562] [50721] (14 PDB entries)
  8. 672976Domain d1euqa1: 1euq A:339-547 [26947]
    Other proteins in same PDB: d1euqa2
    protein/tRNA complex; complexed with qsi; mutant

Details for d1euqa1

PDB Entry: 1euq (more details), 3.1 Å

PDB Description: crystal structure of glutaminyl-trna synthetase complexed with a trna-gln mutant and an active-site inhibitor
PDB Compounds: (A:) glutaminyl-tRNA synthetase

SCOP Domain Sequences for d1euqa1:

Sequence, based on SEQRES records: (download)

>d1euqa1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt

Sequence, based on observed residues (ATOM records): (download)

>d1euqa1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlgvihwvsaahalpvei
rlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsr
hstaekpvfnrtvglrdt

SCOP Domain Coordinates for d1euqa1:

Click to download the PDB-style file with coordinates for d1euqa1.
(The format of our PDB-style files is described here.)

Timeline for d1euqa1: