SCOPe 2.08: Domain d1euqa1: 1euq A:339-547

Lineage for d1euqa1 (1euq A:339-547)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
   barrel, closed; n=6, S=10; complex topology

4. Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families)

5. Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)
   automatically mapped to Pfam PF03950

6. Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (2 species)
   duplication, consists of two barrel domains with the swapping of N-terminal strands

7. Species Escherichia coli [TaxId:562] [50721] (17 PDB entries)

8. Domain d1euqa1: 1euq A:339-547 [26947]
   Other proteins in same PDB: d1euqa2
   protein/RNA complex; complexed with qsi; mutant

Details for d1euqa1

PDB Entry: 1euq, 3.1 Å

PDB Description: crystal structure of glutaminyl-trna synthetase complexed with a trna-gln mutant and an active-site inhibitor

PDB Compounds: (A:) glutaminyl-tRNA synthetase

SCOPe Domain Sequences for d1euqa1:

Sequence, based on SEQRES records:

>d1euqa1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt

Sequence, based on observed residues (ATOM records):

>d1euqa1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlgvihwvsaahalpvei
rlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsr
hstaekpvfnrtvglrdt

Timeline for d1euqa1:

• d1euqa1 first appeared (with stable ids) in SCOP 1.55
  
• d1euqa1 appears in SCOPe 2.07