Lineage for d1es6a1 (1es6 A:44-194)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.31: EV matrix protein [50011] (1 superfamily)
consists of two beta-sandwich domains of similar topologiesSuperfamily b.31.1: EV matrix protein [50012] (2 families) 
Family b.31.1.1: EV matrix protein [50013] (2 proteins) Protein EV matrix protein [50014] (1 species) Species Ebola virus [TaxId:205488] [50015] (3 PDB entries) 
Domain d1es6a1: 1es6 A:44-194 [83048]
Details for d1es6a1
PDB Entry: 1es6 (more details), 2 Å
PDB Description: crystal structure of the matrix protein of ebola virus
PDB Compounds: (A:) matrix protein vp40SCOPe Domain Sequences for d1es6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1es6a1 b.31.1.1 (A:44-194) EV matrix protein {Ebola virus [TaxId: 205488]}
gdtpsnplrpiaddtidhashtpgsvssafileamvnvisgpkvlmkqipiwlplgvadq
ktysfdsttaaimlasytithfgkatnplvrvnrlgpgipdhplrllrignqaflqefvl
ppvqlpqyftfdltalklitqplpaatwtdd
SCOPe Domain Coordinates for d1es6a1:
Click to download the PDB-style file with coordinates for d1es6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1es6a1:
- d1es6a1 first appeared in SCOP 1.65
- d1es6a1 appears in SCOPe 2.04
- d1es6a1 appears in SCOPe 2.06
- d1es6a1 appears in the current release, SCOPe 2.08
View in 3D
