SCOPe 2.08: Domain d1es6a1: 1es6 A:44-194

Lineage for d1es6a1 (1es6 A:44-194)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.31: EV matrix protein [50011] (1 superfamily)
   consists of two beta-sandwich domains of similar topologies

4. Superfamily b.31.1: EV matrix protein [50012] (2 families)

5. Family b.31.1.1: EV matrix protein [50013] (2 proteins)

6. Protein EV matrix protein [50014] (1 species)

7. Species Ebola virus [TaxId:205488] [50015] (3 PDB entries)

8. Domain d1es6a1: 1es6 A:44-194 [83048]

Details for d1es6a1

PDB Entry: 1es6, 2 Å

PDB Description: crystal structure of the matrix protein of ebola virus

PDB Compounds: (A:) matrix protein vp40

SCOPe Domain Sequences for d1es6a1:

Sequence; same for both SEQRES and ATOM records:

>d1es6a1 b.31.1.1 (A:44-194) EV matrix protein {Ebola virus [TaxId: 205488]}
gdtpsnplrpiaddtidhashtpgsvssafileamvnvisgpkvlmkqipiwlplgvadq
ktysfdsttaaimlasytithfgkatnplvrvnrlgpgipdhplrllrignqaflqefvl
ppvqlpqyftfdltalklitqplpaatwtdd

Timeline for d1es6a1:

• d1es6a1 first appeared in SCOP 1.65
  
• d1es6a1 appears in SCOPe 2.07