Lineage for d1elpa1 (1elp A:1-85)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383151Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2383152Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2383153Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2383191Protein gamma-Crystallin [49697] (9 species)
    duplication consists of two domains of this fold
  7. 2383213Species Cow (Bos taurus), isoform IIIb (D) [TaxId:9913] [49699] (1 PDB entry)
  8. 2383214Domain d1elpa1: 1elp A:1-85 [23596]

Details for d1elpa1

PDB Entry: 1elp (more details), 1.95 Å

PDB Description: gamma-d crystallin structure at 1.95 a resolution
PDB Compounds: (A:) gamma-d crystallin

SCOPe Domain Sequences for d1elpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elpa1 b.11.1.1 (A:1-85) gamma-Crystallin {Cow (Bos taurus), isoform IIIb (D) [TaxId: 9913]}
gkitfyedrgfqgrhyecssdhsnlqpylgrcnsvrvdsgcwmiyeqpnylgpqyflrrg
dypdyqqwmglndsirscrliphag

SCOPe Domain Coordinates for d1elpa1:

Click to download the PDB-style file with coordinates for d1elpa1.
(The format of our PDB-style files is described here.)

Timeline for d1elpa1:

2383214
d1elpa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1elpa2