Lineage for d1eiza_ (1eiz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892882Family c.66.1.2: RNA methyltransferase FtsJ [53339] (1 protein)
    automatically mapped to Pfam PF01728
  6. 2892883Protein RNA methyltransferase FtsJ [53340] (1 species)
  7. 2892884Species Escherichia coli [TaxId:562] [53341] (2 PDB entries)
  8. 2892886Domain d1eiza_: 1eiz A: [34180]
    protein/RNA complex; complexed with sam

Details for d1eiza_

PDB Entry: 1eiz (more details), 1.7 Å

PDB Description: ftsj rna methyltransferase complexed with s-adenosylmethionine
PDB Compounds: (A:) ftsj

SCOPe Domain Sequences for d1eiza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiza_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]}
glrsrawfkldeiqqsdklfkpgmtvvdlgaapggwsqyvvtqiggkgriiacdllpmdp
ivgvdflqgdfrdelvmkallervgdskvqvvmsdmapnmsgtpavdipramylvelale
mcrdvlapggsfvvkvfqgegfdeylreirslftkvkvrkpdssrarsrevyivatgrkp

SCOPe Domain Coordinates for d1eiza_:

Click to download the PDB-style file with coordinates for d1eiza_.
(The format of our PDB-style files is described here.)

Timeline for d1eiza_: