Lineage for d1ehwb_ (1ehw B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) 
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) 
Species Human (Homo sapiens), NDK4 [TaxId:9606] [54923] (1 PDB entry) 
Domain d1ehwb_: 1ehw B: [39089]
complexed with so4
Details for d1ehwb_
PDB Entry: 1ehw (more details), 2.4 Å
PDB Description: human nucleoside diphosphate kinase 4
PDB Compounds: (B:) Nucleoside diphosphate kinaseSCOPe Domain Sequences for d1ehwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehwb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]}
mgtrertlvavkpdgvqrrlvgdviqrferrgftlvgmkmlqapesvlaehyqdlrrkpf
ypalirymssgpvvamvwegynvvrasramightdsaeaapgtirgdfsvhisrnvihas
dsvegaqreiqlwfqsselvsw
SCOPe Domain Coordinates for d1ehwb_:
Click to download the PDB-style file with coordinates for d1ehwb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ehwb_:
- d1ehwb_ first appeared (with stable ids) in SCOP 1.55
- d1ehwb_ appears in SCOPe 2.07
View in 3D
