PDB entry 1ehw

View 1ehw on RCSB PDB site
Description: human nucleoside diphosphate kinase 4
Class: transferase
Keywords: nucleoside diphosphate kinase, nm23, mitochondrial, killer-of-prune, TRANSFERASE
Deposited on 2000-02-23, released 2000-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00746 (Start-161)
      • see remark 999 (19-21)
    Domains in SCOPe 2.07: d1ehwa_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00746 (Start-161)
      • see remark 999 (20-21)
    Domains in SCOPe 2.07: d1ehwb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ehwA (A:)
    mgsshhhhhhssglvprgshmgtrertlvavkpdgvqrrlvgdviqrferrgftlvgmkm
    lqapesvlaehyqdlrrkpfypalirymssgpvvamvwegynvvrasramightdsaeaa
    pgtirgdfsvhisrnvihasdsvegaqreiqlwfqsselvsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehwA (A:)
    hmgtrertlvavkpdgvqrrlvgdviqrferrgftlvgmkmlqapesvlaehyqdlrrkp
    fypalirymssgpvvamvwegynvvrasramightdsaeaapgtirgdfsvhisrnviha
    sdsvegaqreiqlwfqsselvsw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ehwB (B:)
    mgsshhhhhhssglvprgshmgtrertlvavkpdgvqrrlvgdviqrferrgftlvgmkm
    lqapesvlaehyqdlrrkpfypalirymssgpvvamvwegynvvrasramightdsaeaa
    pgtirgdfsvhisrnvihasdsvegaqreiqlwfqsselvsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehwB (B:)
    mgtrertlvavkpdgvqrrlvgdviqrferrgftlvgmkmlqapesvlaehyqdlrrkpf
    ypalirymssgpvvamvwegynvvrasramightdsaeaapgtirgdfsvhisrnvihas
    dsvegaqreiqlwfqsselvsw