Lineage for d1ebaa2 (1eba A:117-224)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Erythropoietin (EPO) receptor [49282] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries) 
Domain d1ebaa2: 1eba A:117-224 [22016]
Details for d1ebaa2
PDB Entry: 1eba (more details), 2.7 Å
PDB Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an inactive peptide [emp33] contains 3,5-dibromotyrosine in position 4 (denoted dby)
PDB Compounds: (A:) protein (erythropoietin receptor)SCOPe Domain Sequences for d1ebaa2:
Sequence, based on SEQRES records: (download)
>d1ebaa2 b.1.2.1 (A:117-224) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdl
Sequence, based on observed residues (ATOM records): (download)
>d1ebaa2 b.1.2.1 (A:117-224) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsaggsvqrveilegrt
ecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdl
SCOPe Domain Coordinates for d1ebaa2:
Click to download the PDB-style file with coordinates for d1ebaa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ebaa2:
- d1ebaa2 first appeared (with stable ids) in SCOP 1.55
- d1ebaa2 appears in SCOPe 2.07
View in 3D
