Lineage for d1eb7a2 (1eb7 A:165-323)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily)
core: 3 helices; folded leaf, openedSuperfamily a.3.1: Cytochrome c [46626] (9 families) 
covalently-bound heme completes the core
Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
duplication: contains two cytochrome c-type domainsProtein Di-heme cytochrome c peroxidase [46686] (3 species) Species Pseudomonas aeruginosa [TaxId:287] [46687] (2 PDB entries) 
Domain d1eb7a2: 1eb7 A:165-323 [59405]
complexed with ca, hec
Details for d1eb7a2
PDB Entry: 1eb7 (more details), 2.4 Å
PDB Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa
PDB Compounds: (A:) cytochrome c551 peroxidaseSCOPe Domain Sequences for d1eb7a2:
Sequence, based on SEQRES records: (download)
>d1eb7a2 a.3.1.5 (A:165-323) Di-heme cytochrome c peroxidase {Pseudomonas aeruginosa [TaxId: 287]}
tpdspfdlylkgddkaldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdasv
lpsgdkgrfavtktqsdeyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkql
apddvenivaflhslsgkqprveypllpastettprpae
Sequence, based on observed residues (ATOM records): (download)
>d1eb7a2 a.3.1.5 (A:165-323) Di-heme cytochrome c peroxidase {Pseudomonas aeruginosa [TaxId: 287]}
tpdspfdlylkgddkaldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdadk
grfavtktqsdeyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkqlapddve
nivaflhslsgkqprveypllpastettprpae
SCOPe Domain Coordinates for d1eb7a2:
Click to download the PDB-style file with coordinates for d1eb7a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eb7a2:
- d1eb7a2 first appeared in SCOP 1.57
- d1eb7a2 appears in SCOPe 2.07
View in 3D
