Lineage for d1e8ka_ (1e8k A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553283Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1553284Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1553285Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1553286Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 1553292Species Caenorhabditis elegans, isoform 3 [TaxId:6239] [50899] (3 PDB entries)
  8. 1553295Domain d1e8ka_: 1e8k A: [64797]
    complexed with ala, pro

Details for d1e8ka_

PDB Entry: 1e8k (more details), 1.9 Å

PDB Description: cyclophilin 3 complexed with dipeptide ala-pro
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase 3

SCOPe Domain Sequences for d1e8ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ka_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]}
msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlka

SCOPe Domain Coordinates for d1e8ka_:

Click to download the PDB-style file with coordinates for d1e8ka_.
(The format of our PDB-style files is described here.)

Timeline for d1e8ka_: