| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
| Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
| Protein Phosphoglycerate mutase [53256] (6 species) |
| Species Escherichia coli [TaxId:562] [64110] (2 PDB entries) |
| Domain d1e59a_: 1e59 A: [64794] complexed with cl, vo3 |
PDB Entry: 1e59 (more details), 1.3 Å
SCOPe Domain Sequences for d1e59a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e59a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]}
vtklvlvrhgesqwnkenrftgwydvdlsekgvseakaagkllkeegysfdfaytsvlkr
aihtlwnvldeldqawlpvekswklnerhygalqglnkaetaekygdeqvkqwrrgfavt
ppeltkdderypghdpryaklsekelplteslaltidrvipywnetilprmksgerviia
ahgnslralvkyldnmseeeilelniptgvplvyefdenfkplkryylgnadeiaakaa
Timeline for d1e59a_: