Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species) |
Species Human (Homo sapiens), des1-7 [TaxId:9606] [54080] (8 PDB entries) |
Domain d1dzaa_: 1dza A: [37275] designed cytotoxic mutant |
PDB Entry: 1dza (more details), 1.65 Å
SCOPe Domain Sequences for d1dzaa_:
Sequence, based on SEQRES records: (download)
>d1dzaa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]} mkesaaakferqhmdsgnspsssstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcf qekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvh fdasve
>d1dzaa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]} mkesaaakferqhmdsgnstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcfqekvt ckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasv e
Timeline for d1dzaa_: