Class a: All alpha proteins [46456] (289 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins) consists of four heme-binding repeats automatically mapped to Pfam PF02276 |
Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [48709] (21 PDB entries) |
Domain d1dxrc_: 1dxr C: [19670] Other proteins in same PDB: d1dxrh1, d1dxrh2, d1dxrl_, d1dxrm_ complexed with bcb, bpb, fe2, hec, lda, mq9, mst, ns5, so4; mutant |
PDB Entry: 1dxr (more details), 2 Å
SCOPe Domain Sequences for d1dxrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxrc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]} cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea pqadcrtchqgvtkplfgasrlkdypelgpik
Timeline for d1dxrc_:
View in 3D Domains from other chains: (mouse over for more information) d1dxrh1, d1dxrh2, d1dxrl_, d1dxrm_ |