Lineage for d1dlra_ (1dlr A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1180768Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1180769Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1180770Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1180914Protein Dihydrofolate reductases, eukaryotic type [53605] (6 species)
  7. 1180951Species Human (Homo sapiens) [TaxId:9606] [53607] (52 PDB entries)
  8. 1180999Domain d1dlra_: 1dlr A: [34909]
    complexed with mxa, ndp

Details for d1dlra_

PDB Entry: 1dlr (more details), 2.3 Å

PDB Description: methotrexate-resistant variants of human dihydrofolate reductase with substitution of leucine 22: kinetics, crystallography and potential as selectable markers
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1dlra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlra_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]}
vgslncivavsqnmgigkngdfpwpplrnefryfqrmtttssvegkqnlvimgkktwfsi
peknrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd

SCOPe Domain Coordinates for d1dlra_:

Click to download the PDB-style file with coordinates for d1dlra_.
(The format of our PDB-style files is described here.)

Timeline for d1dlra_: