Lineage for d1dkgd1 (1dkg D:3-185)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605292Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 1605370Species Escherichia coli, gene dnaK [TaxId:562] [53072] (1 PDB entry)
  8. 1605371Domain d1dkgd1: 1dkg D:3-185 [33427]
    Other proteins in same PDB: d1dkga1, d1dkga2, d1dkgb1, d1dkgb2

Details for d1dkgd1

PDB Entry: 1dkg (more details), 2.8 Å

PDB Description: crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak
PDB Compounds: (D:) molecular chaperone dnak

SCOPe Domain Sequences for d1dkgd1:

Sequence, based on SEQRES records: (download)

>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]}
kiigidlgttnscvaimdgttprvlenaegdrttpsiiaytqdgetlvgqpakrqavtnp
qntlfaikrligrrfqdeevqrdvsimpfkiiaadngdawvevkgqkmappqisaevlkk
mkktaedylgepvteavitvpayfndaqrqatkdagriaglevkriineptaaalaygld
kgt

Sequence, based on observed residues (ATOM records): (download)

>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]}
kiigidlgttnscvaimdgttprvlenaegdrttpsiiaytqdgetlvgqpakrqavtnp
qntlfaikrligrrfqdeevqrdvsimpfkiiaadngdawvevkgqkmappqisaevlkk
mkktaedylgepvteavitvpayfndaqrqatkdagriaglevkriineptaaalaygld
kt

SCOPe Domain Coordinates for d1dkgd1:

Click to download the PDB-style file with coordinates for d1dkgd1.
(The format of our PDB-style files is described here.)

Timeline for d1dkgd1: