| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) ![]() |
| Family d.151.1.1: DNase I-like [56220] (7 proteins) |
| Protein DNA repair endonuclease Hap1 [56223] (1 species) Major apurinic/apyrimidinic endonuclease APE1 |
| Species Human (Homo sapiens) [TaxId:9606] [56224] (7 PDB entries) |
| Domain d1dewb_: 1dew B: [41787] protein/DNA complex; complexed with so4 |
PDB Entry: 1dew (more details), 2.65 Å
SCOPe Domain Sequences for d1dewb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dewb_ d.151.1.1 (B:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
egpalyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkc
senklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrviv
aefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeid
lrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvg
wrldyfllshsllpalcdskirskalgsdhcpitlylal
Timeline for d1dewb_: