Class a: All alpha proteins [46456] (285 folds) |
Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) automatically mapped to Pfam PF04253 |
Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins) |
Protein Transferrin receptor ectodomain, C-terminal domain [47674] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47675] (4 PDB entries) |
Domain d1de4c1: 1de4 C:609-756 [17779] Other proteins in same PDB: d1de4a1, d1de4a2, d1de4b_, d1de4c2, d1de4c3, d1de4d1, d1de4d2, d1de4e_, d1de4f2, d1de4f3, d1de4g1, d1de4g2, d1de4h_, d1de4i2, d1de4i3 complexed with ca, gol, nag |
PDB Entry: 1de4 (more details), 2.8 Å
SCOPe Domain Sequences for d1de4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1de4c1 a.48.2.1 (C:609-756) Transferrin receptor ectodomain, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ldyerynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfgnaektdr fvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkqnngafne tlfrnqlalatwtiqgaanalsgdvwdi
Timeline for d1de4c1: