Lineage for d1d2ba_ (1d2b A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398847Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 2398848Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
    contains an irregular alpha+beta subdomain in the C-terminal extension
    automatically mapped to Pfam PF00965
  6. 2398849Protein TIMP-1 [50244] (1 species)
  7. 2398850Species Human (Homo sapiens) [TaxId:9606] [50245] (8 PDB entries)
  8. 2398862Domain d1d2ba_: 1d2b A: [25234]

Details for d1d2ba_

PDB Entry: 1d2b (more details)

PDB Description: the mmp-inhibitory, n-terminal domain of human tissue inhibitor of metalloproteinases-1 (n-timp-1), solution nmr, 29 structures
PDB Compounds: (A:) tissue inhibitor of metalloproteinases-1

SCOPe Domain Sequences for d1d2ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ba_ b.40.3.1 (A:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
tvgcee

SCOPe Domain Coordinates for d1d2ba_:

Click to download the PDB-style file with coordinates for d1d2ba_.
(The format of our PDB-style files is described here.)

Timeline for d1d2ba_: