Lineage for d1czpa_ (1czp A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1638761Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1638762Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1638763Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 1638764Species Anabaena sp., pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)
  8. 1638765Domain d1czpa_: 1czp A: [37645]
    complexed with fes

Details for d1czpa_

PDB Entry: 1czp (more details), 1.17 Å

PDB Description: anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a
PDB Compounds: (A:) ferredoxin I

SCOPe Domain Sequences for d1czpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Anabaena sp., pcc 7119 and 7120 [TaxId: 1167]}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly

SCOPe Domain Coordinates for d1czpa_:

Click to download the PDB-style file with coordinates for d1czpa_.
(The format of our PDB-style files is described here.)

Timeline for d1czpa_: