Lineage for d1cnt1_ (1cnt 1:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767022Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 767023Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 767024Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 767025Protein Ciliary neurotrophic factor (CNTF) [47280] (1 species)
  7. 767026Species Human (Homo sapiens) [TaxId:9606] [47281] (1 PDB entry)
  8. 767027Domain d1cnt1_: 1cnt 1: [16840]

Details for d1cnt1_

PDB Entry: 1cnt (more details), 2.4 Å

PDB Description: ciliary neurotrophic factor
PDB Compounds: (1:) ciliary neurotrophic factor

SCOP Domain Sequences for d1cnt1_:

Sequence, based on SEQRES records: (download)

>d1cnt1_ a.26.1.1 (1:) Ciliary neurotrophic factor (CNTF) {Human (Homo sapiens) [TaxId: 9606]}
phrrdlcsrsiwlarkirsdltaltesyvkhqglnkninldsadgmpvastdqwseltea
erlqenlqayrtfhvllarlledqqvhftptegdfhqaihtlllqvaafayqieelmill
eykiprneadgmpinvgdgglfekklwglkvlqelsqwtvrsihdlrfisshqtgip

Sequence, based on observed residues (ATOM records): (download)

>d1cnt1_ a.26.1.1 (1:) Ciliary neurotrophic factor (CNTF) {Human (Homo sapiens) [TaxId: 9606]}
phrrdlcsrsiwlarkirsdltaltesyvkhqglwselteaerlqenlqayrtfhvllar
lledqqvhftptegdfhqaihtlllqvaafayqieelmilleykiprneadgmlfekklw
glkvlqelsqwtvrsihdlrfisshqtgip

SCOP Domain Coordinates for d1cnt1_:

Click to download the PDB-style file with coordinates for d1cnt1_.
(The format of our PDB-style files is described here.)

Timeline for d1cnt1_: