SCOPe 2.08: Domain d1cnt1_: 1cnt 1:

Lineage for d1cnt1_ (1cnt 1:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Ciliary neurotrophic factor (CNTF) [47280] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47281] (1 PDB entry)

8. Domain d1cnt1_: 1cnt 1: [16840]
   complexed with so4, yb
   missing some secondary structures that made up less than one-third of the common domain

Details for d1cnt1_

PDB Entry: 1cnt, 2.4 Å

PDB Description: ciliary neurotrophic factor

PDB Compounds: (1:) ciliary neurotrophic factor

SCOPe Domain Sequences for d1cnt1_:

Sequence, based on SEQRES records:

>d1cnt1_ a.26.1.1 (1:) Ciliary neurotrophic factor (CNTF) {Human (Homo sapiens) [TaxId: 9606]}
phrrdlcsrsiwlarkirsdltaltesyvkhqglnkninldsadgmpvastdqwseltea
erlqenlqayrtfhvllarlledqqvhftptegdfhqaihtlllqvaafayqieelmill
eykiprneadgmpinvgdgglfekklwglkvlqelsqwtvrsihdlrfisshqtgip

Sequence, based on observed residues (ATOM records):

>d1cnt1_ a.26.1.1 (1:) Ciliary neurotrophic factor (CNTF) {Human (Homo sapiens) [TaxId: 9606]}
phrrdlcsrsiwlarkirsdltaltesyvkhqglwselteaerlqenlqayrtfhvllar
lledqqvhftptegdfhqaihtlllqvaafayqieelmilleykiprneadgmlfekklw
glkvlqelsqwtvrsihdlrfisshqtgip

Timeline for d1cnt1_:

• d1cnt1_ first appeared (with stable ids) in SCOP 1.55
  
• d1cnt1_ appears in SCOPe 2.07