Lineage for d1cjga_ (1cjg A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1488831Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1488832Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1489106Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 1489122Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 1489123Species Escherichia coli [TaxId:562] [47442] (14 PDB entries)
  8. 1489132Domain d1cjga_: 1cjg A: [17112]
    protein/DNA complex

Details for d1cjga_

PDB Entry: 1cjg (more details)

PDB Description: nmr structure of lac repressor hp62-dna complex
PDB Compounds: (A:) protein (lac repressor)

SCOPe Domain Sequences for d1cjga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjga_ a.35.1.5 (A:) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
sl

SCOPe Domain Coordinates for d1cjga_:

Click to download the PDB-style file with coordinates for d1cjga_.
(The format of our PDB-style files is described here.)

Timeline for d1cjga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cjgb_