Lineage for d1cf5a_ (1cf5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000021Protein Beta-momorcharin [56379] (1 species)
    (almost) identical with the anti-tumor and anti-HIV-1 protein MAP30
  7. 3000022Species Bitter gourd (Momordica charantia) [TaxId:3673] [56380] (2 PDB entries)
  8. 3000023Domain d1cf5a_: 1cf5 A: [42191]

Details for d1cf5a_

PDB Entry: 1cf5 (more details), 2.55 Å

PDB Description: beta-momorcharin structure at 2.55 a
PDB Compounds: (A:) protein (beta-momorcharin)

SCOPe Domain Sequences for d1cf5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf5a_ d.165.1.1 (A:) Beta-momorcharin {Bitter gourd (Momordica charantia) [TaxId: 3673]}
dvnfdlstataktytkfiedfratlpfshkvydipllystisdsrrfillnltsyayeti
svaidvtnvyvvayrtrdvsyffkesppeaynilfkgtrkitlpytgnyenlqtaahkir
enidlglpalssaittlfyynaqsapsallvliqttaeaarfkyierhvakyvatnfkpn
laiislenqwsalskqiflaqnqggkfrnpvdlikptgqrfqvtnvdsdvvkgnikllln
srastaden

SCOPe Domain Coordinates for d1cf5a_:

Click to download the PDB-style file with coordinates for d1cf5a_.
(The format of our PDB-style files is described here.)

Timeline for d1cf5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cf5b_