PDB entry 1cf5

View 1cf5 on RCSB PDB site
Description: beta-momorcharin structure at 2.55 a
Class: ribosome-inactivating protein
Keywords: ribosome-inactivating protein, RNA n-glycosidase activity, glycoprotein
Deposited on 1999-03-24, released 1999-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (beta-momorcharin)
    Species: Momordica charantia [TaxId:3673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29339 (0-248)
      • conflict (50)
      • conflict (218)
    Domains in SCOPe 2.07: d1cf5a_
  • Chain 'B':
    Compound: protein (beta-momorcharin)
    Species: Momordica charantia [TaxId:3673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29339 (0-248)
      • conflict (50)
      • conflict (218)
    Domains in SCOPe 2.07: d1cf5b_
  • Heterogens: FUC, NAG, BMA, MAN, XYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cf5A (A:)
    dvnfdlstataktytkfiedfratlpfshkvydipllystisdsrrfillnltsyayeti
    svaidvtnvyvvayrtrdvsyffkesppeaynilfkgtrkitlpytgnyenlqtaahkir
    enidlglpalssaittlfyynaqsapsallvliqttaeaarfkyierhvakyvatnfkpn
    laiislenqwsalskqiflaqnqggkfrnpvdlikptgqrfqvtnvdsdvvkgnikllln
    srastaden
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cf5B (B:)
    dvnfdlstataktytkfiedfratlpfshkvydipllystisdsrrfillnltsyayeti
    svaidvtnvyvvayrtrdvsyffkesppeaynilfkgtrkitlpytgnyenlqtaahkir
    enidlglpalssaittlfyynaqsapsallvliqttaeaarfkyierhvakyvatnfkpn
    laiislenqwsalskqiflaqnqggkfrnpvdlikptgqrfqvtnvdsdvvkgnikllln
    srastaden