Lineage for d1cela_ (1cel A:)
- Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
contains many insertions in the common fold
Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species) 
Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (11 PDB entries) 
Domain d1cela_: 1cel A: [24280]
complexed with bgc, ca, glc, ibz, nag
Details for d1cela_
PDB Entry: 1cel (more details), 1.8 Å
PDB Description: the three-dimensional crystal structure of the catalytic core of cellobiohydrolase i from trichoderma reesei
PDB Compounds: (A:) 1,4-beta-d-glucan cellobiohydrolase ISCOPe Domain Sequences for d1cela_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cela_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsigfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg
SCOPe Domain Coordinates for d1cela_:
Click to download the PDB-style file with coordinates for d1cela_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cela_:
- d1cela_ first appeared (with stable ids) in SCOP 1.55
- d1cela_ appears in SCOPe 2.01
- d1cela_ appears in SCOPe 2.03
- d1cela_ appears in the current release, SCOPe 2.08
View in 3D
