Lineage for d1cdia1 (1cdi A:0-97)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781640Protein CD4 V-set domains [48737] (2 species)
  7. 781641Species Human (Homo sapiens) [TaxId:9606] [48738] (26 PDB entries)
  8. 781663Domain d1cdia1: 1cdi A:0-97 [19727]
    Other proteins in same PDB: d1cdia2
    domain 1

Details for d1cdia1

PDB Entry: 1cdi (more details), 2.9 Å

PDB Description: structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices
PDB Compounds: (A:) t cell surface glycoprotein cd4

SCOP Domain Sequences for d1cdia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdia1 b.1.1.1 (A:0-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
tkkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrr
slwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOP Domain Coordinates for d1cdia1:

Click to download the PDB-style file with coordinates for d1cdia1.
(The format of our PDB-style files is described here.)

Timeline for d1cdia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cdia2