Lineage for d1cdi_1 (1cdi 0-97)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7022Protein CD4 [48737] (2 species)
  7. 7023Species Human (Homo sapiens) [TaxId:9606] [48738] (12 PDB entries)
  8. 7032Domain d1cdi_1: 1cdi 0-97 [19727]
    Other proteins in same PDB: d1cdi_2

Details for d1cdi_1

PDB Entry: 1cdi (more details), 2.9 Å

PDB Description: structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices
PDB Compounds: ( :)

SCOP Domain Sequences for d1cdi_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdi_1 b.1.1.1 (0-97) CD4 {Human (Homo sapiens)}
tkkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrr
slwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOP Domain Coordinates for d1cdi_1:

Click to download the PDB-style file with coordinates for d1cdi_1.
(The format of our PDB-style files is described here.)

Timeline for d1cdi_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cdi_2