Lineage for d1cb2a_ (1cb2 A:)
- Root: SCOPe 2.02
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) 
Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
Pfam PF01341
Protein Cellobiohydrolase II (Cel6) [51993] (3 species) 
Species Trichoderma reesei, Cel6a [TaxId:51453] [51994] (7 PDB entries) 
Domain d1cb2a_: 1cb2 A: [30661]
complexed with man, nag; mutant
Details for d1cb2a_
PDB Entry: 1cb2 (more details), 2 Å
PDB Description: cellobiohydrolase ii, catalytic domain, mutant y169f
PDB Compounds: (A:) cellobiohydrolase IISCOPe Domain Sequences for d1cb2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cb2a_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Trichoderma reesei, Cel6a [TaxId: 51453]}
tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
meqtladirtanknggnyagqfvvfdlpdrdcaalasngeysiadggvakyknyidtirq
ivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
sfl
SCOPe Domain Coordinates for d1cb2a_:
Click to download the PDB-style file with coordinates for d1cb2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cb2a_:
- d1cb2a_ first appeared (with stable ids) in SCOP 1.55
- d1cb2a_ appears in SCOPe 2.01
- d1cb2a_ appears in SCOPe 2.03
- d1cb2a_ appears in the current release, SCOPe 2.08
View in 3D
