Lineage for d1c5ka1 (1c5k A:163-431)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 807413Superfamily b.68.4: TolB, C-terminal domain [50960] (1 family) (S)
  5. 807414Family b.68.4.1: TolB, C-terminal domain [50961] (1 protein)
  6. 807415Protein TolB, C-terminal domain [50962] (1 species)
  7. 807416Species Escherichia coli [TaxId:562] [50963] (4 PDB entries)
  8. 807426Domain d1c5ka1: 1c5k A:163-431 [27630]
    Other proteins in same PDB: d1c5ka2
    complexed with yb

Details for d1c5ka1

PDB Entry: 1c5k (more details), 2 Å

PDB Description: the structure of tolb, an essential component of the tol-dependent translocation system and its interactions with the translocation domain of colicin e9
PDB Compounds: (A:) protein (tolb protein)

SCOP Domain Sequences for d1c5ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5ka1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir
qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss
dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkfpawspyl

SCOP Domain Coordinates for d1c5ka1:

Click to download the PDB-style file with coordinates for d1c5ka1.
(The format of our PDB-style files is described here.)

Timeline for d1c5ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c5ka2