SCOP 1.73: Domain d1c5ka1: 1c5k A:163-431

Lineage for d1c5ka1 (1c5k A:163-431)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.4: TolB, C-terminal domain [50960] (1 family)

5. Family b.68.4.1: TolB, C-terminal domain [50961] (1 protein)

6. Protein TolB, C-terminal domain [50962] (1 species)

7. Species Escherichia coli [TaxId:562] [50963] (4 PDB entries)

8. Domain d1c5ka1: 1c5k A:163-431 [27630]
   Other proteins in same PDB: d1c5ka2
   complexed with yb

Details for d1c5ka1

PDB Entry: 1c5k, 2 Å

PDB Description: the structure of tolb, an essential component of the tol-dependent translocation system and its interactions with the translocation domain of colicin e9

PDB Compounds: (A:) protein (tolb protein)

SCOP Domain Sequences for d1c5ka1:

Sequence; same for both SEQRES and ATOM records:

>d1c5ka1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir
qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss
dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkfpawspyl

Timeline for d1c5ka1:

• d1c5ka1 first appeared (with stable ids) in SCOP 1.55
  
• d1c5ka1 appears in SCOP 1.71
  
• d1c5ka1 appears in SCOP 1.75
  
• d1c5ka1 appears in the current release, SCOPe 2.08