Lineage for d1bzma_ (1bzm A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 961516Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 961517Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 961518Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
  6. 961519Protein Carbonic anhydrase [51071] (10 species)
  7. 961525Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (16 PDB entries)
  8. 961539Domain d1bzma_: 1bzm A: [27817]
    complexed with mzm, zn

Details for d1bzma_

PDB Entry: 1bzm (more details), 2 Å

PDB Description: drug-protein interactions: structure of sulfonamide drug complexed with human carbonic anhydrase i
PDB Compounds: (A:) carbonic anhydrase I

SCOPe Domain Sequences for d1bzma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzma_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
aspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeii
nvghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhv
ahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfd
pstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavp
mqhnnrptqplkgrtvrasf

SCOPe Domain Coordinates for d1bzma_:

Click to download the PDB-style file with coordinates for d1bzma_.
(The format of our PDB-style files is described here.)

Timeline for d1bzma_: