Lineage for d1bzda_ (1bzd A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378753Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2378754Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2378755Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2378776Species Human (Homo sapiens) [TaxId:9606] [49475] (320 PDB entries)
    Uniprot P02766 31-143
  8. 2379391Domain d1bzda_: 1bzd A: [22575]

Details for d1bzda_

PDB Entry: 1bzd (more details), 1.9 Å

PDB Description: tertiary structures of three amyloidogenic transthyretin variants and implications for amyloid fibril formation
PDB Compounds: (A:) protein (transthyretin)

SCOPe Domain Sequences for d1bzda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzda_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
gptgtseskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vvtnpke

SCOPe Domain Coordinates for d1bzda_:

Click to download the PDB-style file with coordinates for d1bzda_.
(The format of our PDB-style files is described here.)

Timeline for d1bzda_:

2379391
d1bzda_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1bzdb_