Lineage for d1bqna2 (1bqn A:1-429)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2247182Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 2247183Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 2247227Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (172 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2247554Domain d1bqna2: 1bqn A:1-429 [43064]
    Other proteins in same PDB: d1bqna1
    complexed with hby

Details for d1bqna2

PDB Entry: 1bqn (more details), 3.3 Å

PDB Description: tyr 188 leu hiv-1 rt/hby 097
PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d1bqna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqna2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddllvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpqkdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d1bqna2:

Click to download the PDB-style file with coordinates for d1bqna2.
(The format of our PDB-style files is described here.)

Timeline for d1bqna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqna1
View in 3D
Domains from other chains:
(mouse over for more information)
d1bqnb_