Lineage for d1boya1 (1boy A:3-106)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Extracellular region of human tissue factor [49267] (2 species)
tandem of fibronectin type III domainsSpecies Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
Uniprot P13726 33-242
Domain d1boya1: 1boy A:3-106 [21955]
Details for d1boya1
PDB Entry: 1boy (more details), 2.2 Å
PDB Description: extracellular region of human tissue factor
PDB Compounds: (A:) human tissue factorSCOPe Domain Sequences for d1boya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1boya1 b.1.2.1 (A:3-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
ttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltde
ivkdvkqtylarvfsypagnvestgsageplyenspeftpylet
SCOPe Domain Coordinates for d1boya1:
Click to download the PDB-style file with coordinates for d1boya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1boya1:
- d1boya1 first appeared (with stable ids) in SCOP 1.55, called d1boy_1
- d1boya1 appears in SCOPe 2.04
- d1boya1 appears in SCOPe 2.06
- d1boya1 appears in the current release, SCOPe 2.08
View in 3D
