Lineage for d1bmga_ (1bmg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2745642Species Cow (Bos taurus) [TaxId:9913] [48946] (6 PDB entries)
  8. 2745652Domain d1bmga_: 1bmg A: [20667]

Details for d1bmga_

PDB Entry: 1bmg (more details), 2.5 Å

PDB Description: crystal structure of bovine beta2-microglobulin
PDB Compounds: (A:) beta=2=-microglobulin

SCOPe Domain Sequences for d1bmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmga_ b.1.1.2 (A:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]}
iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl

SCOPe Domain Coordinates for d1bmga_:

Click to download the PDB-style file with coordinates for d1bmga_.
(The format of our PDB-style files is described here.)

Timeline for d1bmga_: