PDB entry 1bmg

View 1bmg on RCSB PDB site
Description: crystal structure of bovine beta2-microglobulin
Class: histocompatibility antigen
Keywords: lactollin, MHC-I histocompatibility antigen, light chain, histocompatibility antigen
Deposited on 1995-07-18, released 1995-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta=2=-microglobulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bmga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmgA (A:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl