Lineage for d1bj3b_ (1bj3 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442895Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 1442896Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88868] (6 PDB entries)
  8. 1442905Domain d1bj3b_: 1bj3 B: [42342]
    Other proteins in same PDB: d1bj3a_
    complexed with ca

Details for d1bj3b_

PDB Entry: 1bj3 (more details), 2.6 Å

PDB Description: crystal structure of coagulation factor ix-binding protein (ix-bp) from venom of habu snake with a heterodimer of c-type lectin domains
PDB Compounds: (B:) protein (coagulation factor ix-binding protein b)

SCOPe Domain Sequences for d1bj3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bj3b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa

SCOPe Domain Coordinates for d1bj3b_:

Click to download the PDB-style file with coordinates for d1bj3b_.
(The format of our PDB-style files is described here.)

Timeline for d1bj3b_: