Lineage for d1bj3b_ (1bj3 B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (5 families) 
Family d.169.1.1: C-type lectin domain [56437] (13 proteins) 
Protein Snake coagglutinin [56446] (3 species) 
Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [56447] (2 PDB entries) 
Domain d1bj3b_: 1bj3 B: [42342]
Details for d1bj3b_
PDB Entry: 1bj3 (more details), 2.6 Å
PDB Description: crystal structure of coagulation factor ix-binding protein (ix-bp) from venom of habu snake with a heterodimer of c-type lectin domains
SCOP Domain Sequences for d1bj3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bj3b_ d.169.1.1 (B:) Snake coagglutinin {Habu snake (Trimeresurus flavoviridis)}
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa
SCOP Domain Coordinates for d1bj3b_:
Click to download the PDB-style file with coordinates for d1bj3b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bj3b_:
- d1bj3b_ appears in SCOP 1.57
- d1bj3b_ appears in the current release, SCOPe 2.08
View in 3D
