Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) |
Family d.104.1.2: Biotin holoenzyme synthetase [55707] (1 protein) |
Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species) this structure contains an SH2-like fold |
Species Escherichia coli [TaxId:562] [55709] (3 PDB entries) |
Domain d1bia_3: 1bia 64-270 [40787] Other proteins in same PDB: d1bia_1, d1bia_2 |
PDB Entry: 1bia (more details), 2.3 Å
SCOP Domain Sequences for d1bia_3:
Sequence, based on SEQRES records: (download)
>d1bia_3 d.104.1.2 (64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli} iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli relraalelfeqeglapylsrwekldn
>d1bia_3 d.104.1.2 (64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli} iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagspfganly lsmfwrleqpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrklagilveltg aaqivigaginmamwitlqeaginldrntlaamlirelraalelfeqeglapylsrwekl dn
Timeline for d1bia_3: