Lineage for d1bia_3 (1bia 64-270)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608836Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 608837Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 609017Family d.104.1.2: Biotin holoenzyme synthetase [55707] (1 protein)
  6. 609018Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species)
    this structure contains an SH2-like fold
  7. 609019Species Escherichia coli [TaxId:562] [55709] (3 PDB entries)
  8. 609020Domain d1bia_3: 1bia 64-270 [40787]
    Other proteins in same PDB: d1bia_1, d1bia_2

Details for d1bia_3

PDB Entry: 1bia (more details), 2.3 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains

SCOP Domain Sequences for d1bia_3:

Sequence, based on SEQRES records: (download)

>d1bia_3 d.104.1.2 (64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli
relraalelfeqeglapylsrwekldn

Sequence, based on observed residues (ATOM records): (download)

>d1bia_3 d.104.1.2 (64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagspfganly
lsmfwrleqpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrklagilveltg
aaqivigaginmamwitlqeaginldrntlaamlirelraalelfeqeglapylsrwekl
dn

SCOP Domain Coordinates for d1bia_3:

Click to download the PDB-style file with coordinates for d1bia_3.
(The format of our PDB-style files is described here.)

Timeline for d1bia_3: