Lineage for d1bhja_ (1bhj A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1864583Family c.66.1.5: Glycine N-methyltransferase [53348] (1 protein)
  6. 1864584Protein Glycine N-methyltransferase [53349] (3 species)
  7. 1864601Species Norway rat (Rattus norvegicus) [TaxId:10116] [53350] (12 PDB entries)
  8. 1864624Domain d1bhja_: 1bhj A: [34189]

Details for d1bhja_

PDB Entry: 1bhj (more details), 2.5 Å

PDB Description: crystal structure of apo-glycine n-methyltransferase (gnmt)
PDB Compounds: (A:) glycine n-methyltransferase

SCOPe Domain Sequences for d1bhja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhja_ c.66.1.5 (A:) Glycine N-methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyi
lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg

SCOPe Domain Coordinates for d1bhja_:

Click to download the PDB-style file with coordinates for d1bhja_.
(The format of our PDB-style files is described here.)

Timeline for d1bhja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bhjb_