Lineage for d1bhja_ (1bhj A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26076Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 26077Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (11 families) (S)
  5. 26095Family c.66.1.5: Glycine N-methyltransferase [53348] (1 protein)
  6. 26096Protein Glycine N-methyltransferase [53349] (1 species)
  7. 26097Species Rat (Rattus norvegicus) [TaxId:10116] [53350] (5 PDB entries)
  8. 26104Domain d1bhja_: 1bhj A: [34189]

Details for d1bhja_

PDB Entry: 1bhj (more details), 2.5 Å

PDB Description: crystal structure of apo-glycine n-methyltransferase (gnmt)

SCOP Domain Sequences for d1bhja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhja_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus)}
vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyi
lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg

SCOP Domain Coordinates for d1bhja_:

Click to download the PDB-style file with coordinates for d1bhja_.
(The format of our PDB-style files is described here.)

Timeline for d1bhja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bhjb_