Lineage for d1b8sa2 (1b8s A:319-450)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
alpha+beta sandwichSuperfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) 
N-terminal domain is beta/beta/alpha common foldFamily d.16.1.1: GMC oxidoreductases [54374] (5 proteins) Protein Cholesterol oxidase [54375] (3 species) Species Streptomyces sp. [TaxId:1931] [54377] (13 PDB entries) 
Domain d1b8sa2: 1b8s A:319-450 [37866]
Other proteins in same PDB: d1b8sa1
complexed with fad; mutant
Details for d1b8sa2
PDB Entry: 1b8s (more details), 1.65 Å
PDB Description: cholesterol oxidase from streptomyces glu361gln mutant
PDB Compounds: (A:) protein (cholesterol oxidase)SCOPe Domain Sequences for d1b8sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8sa2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp. [TaxId: 1931]}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaqiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyhplg
SCOPe Domain Coordinates for d1b8sa2:
Click to download the PDB-style file with coordinates for d1b8sa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b8sa2:
- d1b8sa2 first appeared (with stable ids) in SCOP 1.55
- d1b8sa2 appears in SCOP 1.75
- d1b8sa2 appears in SCOPe 2.02
- d1b8sa2 appears in the current release, SCOPe 2.08
View in 3D
